Bank branch · Source profile
State Bank of India — GUNTAKAL
SBIN0020870
ANANTPUR · ANDHRA PRADESH
Branch information
- IFSC · Compiled source data
- SBIN0020870
- Bank · Compiled source data
- State Bank of India
- Branch · Compiled source data
- GUNTAKAL
- Address · Compiled source data
- 625MAINBAZAROPPSRIKANYAKAPARAMESWARITEMPLEGUNTHAKALANANTHAPURDT
- City · Compiled source data
- ANANTPUR
- District · Compiled source data
- ANANTPUR
- State · Compiled source data
- ANDHRA PRADESH
- MICR · Compiled source data
- 515002305
- Source contact · Compiled source data
- +918552228869
Address search, not a verified map pin.
Payment-service signals
These flags describe the compiled source record, not availability for every account or an assurance that a transfer will succeed.
- NEFT
- Listed as supported
- RTGS
- Listed as supported
- IMPS
- Listed as supported
- UPI
- Listed as supported
Before using SBIN0020870
Check that the beneficiary’s bank and branch match State Bank of India, GUNTAKAL. The source address is 625MAINBAZAROPPSRIKANYAKAPARAMESWARITEMPLEGUNTHAKALANANTHAPURDT. A matching directory result does not confirm an account holder’s identity or validate their account number.
If the branch has moved or merged, obtain current details from the bank. SIRF never asks for banking PINs, passwords or OTPs. Following this profile only follows its SIRF directory activity.
More State Bank of India branches in ANDHRA PRADESH
Data source & freshness
Razorpay IFSC dataset v2.0.62, released 2026-09-01. Retrieved by SIRF on 2026-10-06. The dataset is published under a public-domain dedication; its compilation includes RBI and other payment-network sources. SIRF is an independent directory and is not endorsed by the bank, RBI or Razorpay.
View the source releaseSource archive SHA-256: 90c10afab97341ce5c6def9266720d169b3b8cea87db5acab570be71e0cee679
Represent this branch or report a correction
Only bank-authorized representatives can request management access. Knowing an IFSC does not prove authority. Source facts remain protected, and requests require manual review. Do not submit account details or identity documents.
Manage an authorized branch profile